kocaeliyurt.net rapport :   Visitez le site


Titre:kocaeli escort | kocaeli gerçek escort bayan | kocaeli eskort

La description :kocaeli escortlar arasında gerçek kocaeli escort bayanlar ile tanışın. kocaeli anal escort, kocaeli genç escort, kocaeli olgun escort telefonları doğru escort...

L'adresse IP principale: 184.168.221.82,Votre serveur United States,Scottsdale ISP:GoDaddy.com LLC  TLD:net Code postal:us

Ce rapport est mis à jour en 21-Nov-2017

Created Date:2017-04-22
Changed Date:2017-08-28

Données techniques du kocaeliyurt.net


Geo IP vous fournit comme la latitude, la longitude et l'ISP (Internet Service Provider) etc. informations. Notre service GeoIP a trouvé l'hôte kocaeliyurt.net.Actuellement, hébergé dans United States et son fournisseur de services est GoDaddy.com LLC .

Latitude: 33.601974487305
Longitude: -111.88791656494
Pays: United States (us)
Ville: Scottsdale
Région: Arizona
ISP: GoDaddy.com LLC

the related websites

domaine Titre
kocaeliyurt.net kocaeli escort | kocaeli gerçek escort bayan | kocaeli eskort
izmitce.com kocaeli escort - izmit escort - escort bayan kocaeli ™
kocaeliokulsporlari.com kocaeli escort bayan - izmit escort - gebze escort
kocaeliyapifirmalari.com İzmit escort – kocaeli escort bayan – İzmit escort bayanların bulunduğu escort b
izmithbr.com izmit escort - kocaeli escort - partner bayan
eu-prepaid.com İzmit escort, kocaeli escort partner sitesi
izmitekol.com izmit escort | kocaeli escort
erakarsa.com kocaeli escort, İzmit escort
cedarriverbeads.com izmit escort | kocaeli escort
sourcenao.com izmit escort bayan, kocaeli escort, izmit escort kızlar
sanliurfaemlak.info Şanlıurfa escort | urfa gerçek escort bayan
kahramanmarasevdenevenakliyat.info kahranmaraş escort | maraş gerçek escort bayan
carsambanovada.com x escort | x gerçek escort bayan | x eskort
karaman-escortbayanlar.xyz vip escort | vip gerçek escort bayan | efsane |
kastamonu-escortbayanlar2.xyz vip escort | vip gerçek escort bayan | efsane |

Analyse PopURL pour kocaeliyurt.net


http://kocaeliyurt.net/ad-category/gebzeescort/
http://kocaeliyurt.net/ads/populer-escort-gizem/
http://kocaeliyurt.net/ads/anal-escort-merve/
http://kocaeliyurt.net/ad-category/kocaelitravesti/
http://kocaeliyurt.net/ads/universiteli-escort-ceyda/
http://kocaeliyurt.net/ad-category/kocaelievegelenescort/
http://kocaeliyurt.net/
http://kocaeliyurt.net/ads/kocaeli-genc-escort-bayan/
http://kocaeliyurt.net/ads/turbanli-escort/
http://kocaeliyurt.net/ad-category/daricaescort/
http://kocaeliyurt.net/#block1
http://kocaeliyurt.net/ad-category/kocaelimasoz/
http://kocaeliyurt.net/create-listing/
http://kocaeliyurt.net/ad-category/derinceescort/
http://kocaeliyurt.net/ads/kocaeli-escort-tina/

Informations Whois


Whois est un protocole qui permet d'accéder aux informations d'enregistrement.Vous pouvez atteindre quand le site Web a été enregistré, quand il va expirer, quelles sont les coordonnées du site avec les informations suivantes. En un mot, il comprend ces informations;

Domain Name: KOCAELIYURT.NET
Registry Domain ID: 2116682028_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2017-08-28T14:52:49Z
Creation Date: 2017-04-22T11:30:09Z
Registry Expiry Date: 2018-04-22T11:30:09Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: ELINORE.NS.CLOUDFLARE.COM
Name Server: JEROME.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-11-20T16:58:25Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.

  REGISTRAR GoDaddy.com, LLC

SERVERS

  SERVER net.whois-servers.net

  ARGS domain =kocaeliyurt.net

  PORT 43

  TYPE domain
RegrInfo
DOMAIN

  NAME kocaeliyurt.net

  CHANGED 2017-08-28

  CREATED 2017-04-22

STATUS
clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
clientRenewProhibited https://icann.org/epp#clientRenewProhibited
clientTransferProhibited https://icann.org/epp#clientTransferProhibited
clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited

NSERVER

  ELINORE.NS.CLOUDFLARE.COM 173.245.58.153

  JEROME.NS.CLOUDFLARE.COM 173.245.59.181

  REGISTERED yes

Go to top

Erreurs


La liste suivante vous montre les fautes d'orthographe possibles des internautes pour le site Web recherché.

  • www.ukocaeliyurt.com
  • www.7kocaeliyurt.com
  • www.hkocaeliyurt.com
  • www.kkocaeliyurt.com
  • www.jkocaeliyurt.com
  • www.ikocaeliyurt.com
  • www.8kocaeliyurt.com
  • www.ykocaeliyurt.com
  • www.kocaeliyurtebc.com
  • www.kocaeliyurtebc.com
  • www.kocaeliyurt3bc.com
  • www.kocaeliyurtwbc.com
  • www.kocaeliyurtsbc.com
  • www.kocaeliyurt#bc.com
  • www.kocaeliyurtdbc.com
  • www.kocaeliyurtfbc.com
  • www.kocaeliyurt&bc.com
  • www.kocaeliyurtrbc.com
  • www.urlw4ebc.com
  • www.kocaeliyurt4bc.com
  • www.kocaeliyurtc.com
  • www.kocaeliyurtbc.com
  • www.kocaeliyurtvc.com
  • www.kocaeliyurtvbc.com
  • www.kocaeliyurtvc.com
  • www.kocaeliyurt c.com
  • www.kocaeliyurt bc.com
  • www.kocaeliyurt c.com
  • www.kocaeliyurtgc.com
  • www.kocaeliyurtgbc.com
  • www.kocaeliyurtgc.com
  • www.kocaeliyurtjc.com
  • www.kocaeliyurtjbc.com
  • www.kocaeliyurtjc.com
  • www.kocaeliyurtnc.com
  • www.kocaeliyurtnbc.com
  • www.kocaeliyurtnc.com
  • www.kocaeliyurthc.com
  • www.kocaeliyurthbc.com
  • www.kocaeliyurthc.com
  • www.kocaeliyurt.com
  • www.kocaeliyurtc.com
  • www.kocaeliyurtx.com
  • www.kocaeliyurtxc.com
  • www.kocaeliyurtx.com
  • www.kocaeliyurtf.com
  • www.kocaeliyurtfc.com
  • www.kocaeliyurtf.com
  • www.kocaeliyurtv.com
  • www.kocaeliyurtvc.com
  • www.kocaeliyurtv.com
  • www.kocaeliyurtd.com
  • www.kocaeliyurtdc.com
  • www.kocaeliyurtd.com
  • www.kocaeliyurtcb.com
  • www.kocaeliyurtcom
  • www.kocaeliyurt..com
  • www.kocaeliyurt/com
  • www.kocaeliyurt/.com
  • www.kocaeliyurt./com
  • www.kocaeliyurtncom
  • www.kocaeliyurtn.com
  • www.kocaeliyurt.ncom
  • www.kocaeliyurt;com
  • www.kocaeliyurt;.com
  • www.kocaeliyurt.;com
  • www.kocaeliyurtlcom
  • www.kocaeliyurtl.com
  • www.kocaeliyurt.lcom
  • www.kocaeliyurt com
  • www.kocaeliyurt .com
  • www.kocaeliyurt. com
  • www.kocaeliyurt,com
  • www.kocaeliyurt,.com
  • www.kocaeliyurt.,com
  • www.kocaeliyurtmcom
  • www.kocaeliyurtm.com
  • www.kocaeliyurt.mcom
  • www.kocaeliyurt.ccom
  • www.kocaeliyurt.om
  • www.kocaeliyurt.ccom
  • www.kocaeliyurt.xom
  • www.kocaeliyurt.xcom
  • www.kocaeliyurt.cxom
  • www.kocaeliyurt.fom
  • www.kocaeliyurt.fcom
  • www.kocaeliyurt.cfom
  • www.kocaeliyurt.vom
  • www.kocaeliyurt.vcom
  • www.kocaeliyurt.cvom
  • www.kocaeliyurt.dom
  • www.kocaeliyurt.dcom
  • www.kocaeliyurt.cdom
  • www.kocaeliyurtc.om
  • www.kocaeliyurt.cm
  • www.kocaeliyurt.coom
  • www.kocaeliyurt.cpm
  • www.kocaeliyurt.cpom
  • www.kocaeliyurt.copm
  • www.kocaeliyurt.cim
  • www.kocaeliyurt.ciom
  • www.kocaeliyurt.coim
  • www.kocaeliyurt.ckm
  • www.kocaeliyurt.ckom
  • www.kocaeliyurt.cokm
  • www.kocaeliyurt.clm
  • www.kocaeliyurt.clom
  • www.kocaeliyurt.colm
  • www.kocaeliyurt.c0m
  • www.kocaeliyurt.c0om
  • www.kocaeliyurt.co0m
  • www.kocaeliyurt.c:m
  • www.kocaeliyurt.c:om
  • www.kocaeliyurt.co:m
  • www.kocaeliyurt.c9m
  • www.kocaeliyurt.c9om
  • www.kocaeliyurt.co9m
  • www.kocaeliyurt.ocm
  • www.kocaeliyurt.co
  • kocaeliyurt.netm
  • www.kocaeliyurt.con
  • www.kocaeliyurt.conm
  • kocaeliyurt.netn
  • www.kocaeliyurt.col
  • www.kocaeliyurt.colm
  • kocaeliyurt.netl
  • www.kocaeliyurt.co
  • www.kocaeliyurt.co m
  • kocaeliyurt.net
  • www.kocaeliyurt.cok
  • www.kocaeliyurt.cokm
  • kocaeliyurt.netk
  • www.kocaeliyurt.co,
  • www.kocaeliyurt.co,m
  • kocaeliyurt.net,
  • www.kocaeliyurt.coj
  • www.kocaeliyurt.cojm
  • kocaeliyurt.netj
  • www.kocaeliyurt.cmo
 Afficher toutes les erreurs  Cacher toutes les erreurs